Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Potassium-transporting ATPase subunit beta (Atp4b)

This Recombinant Mouse Potassium-transporting ATPase subunit beta (Atp4b) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase subunit beta, Gastric H (+) /K (+) ATPase subunit beta, Proton pump beta chain

UniProt

P50992

Expression Region

1-294

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALQEKKSCSQRMAEFRHYCWNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLMQTIDPYTPDYQDQLKSPGVTLRPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDSINCTSEKYFFQESFAAPNHTKFSCKFTADMLQNCSGLADPSFGFEEGKPCFIIKMNRIVKFLPSNNTAPRVDCTFQDDPQKPRKDTEPLQVEYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNVPKNMQVSIVCKILADHVTFNNPHDPYEGKVEFKLTIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL
BNC471199-100 1x 100 µL

SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calm5 Mouse Gene Knockout Kit (CRISPR)
KN502465 1 Kit

Calm5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPS6KC1 (N-term) Rabbit Polyclonal Antibody
AP53746PU-N 400 µL

RPS6KC1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Hepteneoylglycine(mixture of E/Z conformers)
TRC-H442960-10MG 10 mg

5-Hepteneoylglycine(mixture of E/Z conformers)

Sign In for Pricing
View Details
LZIC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F1]
TA505942AM 100 µL

LZIC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F1]

Sign In for Pricing
View Details