Recombinant Bufo marinus Sodium/potassium-transporting ATPase subunit beta-2
This Recombinant Bufo marinus Sodium/potassium-transporting ATPase subunit beta-2 spans the amino acid sequence from region 1-299.
Product Specifications
Product Name Alternative
Sodium/potassium-transporting ATPase subunit beta-2, Beta-B1 chain, Sodium/potassium-dependent ATPase beta-2 subunit
UniProt
P43002
Expression Region
1-299
Origin
Bufo marinus (Giant toad) (Cane toad)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAALTQKKTCSQMMEEWKEFMWNPRTREFMGRTGSSWALILLFYVVFYAFLTAVFSLSLWVMLQTIDEYTPKYADRLANPGLMIRPKMDTTEVVYSTNGMNGTWQAYVDNLNSLLKDYNKTVQMERGVNCTPGVYNMQEDTGDVRNNPKKACWFFRDVLGDCSGVSDTTYGYQDGKPCVLIKMNRVINFLPVPIKELSNTSITIKCTAQNNDDLLGSIQYFPSVNNQSLGAIDLMYFPYYGNRAQQNYTQPFVAVKFLNATKGVDHMVECRVNAANINNQDPRDLYQGRVIFTMKIDRL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
268968-01 25 mg
(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-4- (trifluoromethyl) -2H-3,1-benzoxazin-2-one discontinued. See E2213-75
Sign In for Pricing
View Details 268968-02 50 mg
(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-4- (trifluoromethyl) -2H-3,1-benzoxazin-2-one discontinued. See E2213-75
Sign In for Pricing
View Details 268968-03 100 mg
(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-4- (trifluoromethyl) -2H-3,1-benzoxazin-2-one discontinued. See E2213-75
Sign In for Pricing
View Details 268968-04 250 mg
(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-4- (trifluoromethyl) -2H-3,1-benzoxazin-2-one discontinued. See E2213-75
Sign In for Pricing
View Details 268968-05 500 mg
(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-4- (trifluoromethyl) -2H-3,1-benzoxazin-2-one discontinued. See E2213-75
Sign In for Pricing
View Details 