Recombinant Mouse Lymphotoxin-beta (Ltb)
This Recombinant Mouse Lymphotoxin-beta (Ltb) spans the amino acid sequence from region 1-306.
Product Specifications
Product Name Alternative
Lymphotoxin-beta, LT-beta, Tumor necrosis factor C, TNF-C, Tumor necrosis factor ligand superfamily member 3
UniProt
P41155
Expression Region
1-306
Origin
Mus musculus (Mouse)
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1662-Cy3 100 µg/Vial
Anti-Netrin 1/NTN1 Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 