Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat T-cell surface antigen CD2 (Cd2)

This Recombinant Rat T-cell surface antigen CD2 (Cd2) spans the amino acid sequence from region 23-344.

Product Specifications

Product Name Alternative

T-cell surface antigen CD2, LFA-2, LFA-3 receptor, OX-34 antigen, T-cell surface antigen T11/Leu-5, CD_antigen= CD2

UniProt

P08921

Expression Region

23-344

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA5 (Defensin-5, Defensin, alpha 5, HD5(20-94), DEF5) (FITC)
MBS6375988-01 0.1 mL

DEFA5 (Defensin-5, Defensin, alpha 5, HD5(20-94), DEF5) (FITC)

Sign In for Pricing
View Details
DEFA5 (Defensin-5, Defensin, alpha 5, HD5(20-94), DEF5) (FITC)
MBS6375988-02 5x 0.1 mL

DEFA5 (Defensin-5, Defensin, alpha 5, HD5(20-94), DEF5) (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Nampt shRNA (UAS) - Lentiviral mouse Nampt shRNA (UAS, RFP) plasmid
GTR15222565 1 Vial

Lentiviral mouse Nampt shRNA (UAS) - Lentiviral mouse Nampt shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Esterase FrsA (frsA)
MBS1071870-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Esterase FrsA (frsA)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Esterase FrsA (frsA)
MBS1071870-02 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A Esterase FrsA (frsA)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Esterase FrsA (frsA)
MBS1071870-03 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A Esterase FrsA (frsA)

Sign In for Pricing
View Details