Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface antigen CD2 (Cd2)

This Recombinant Mouse T-cell surface antigen CD2 (Cd2) spans the amino acid sequence from region 23-344.

Product Specifications

Product Name Alternative

T-cell surface antigen CD2, LFA-2, LFA-3 receptor, Lymphocyte antigen 37, Ly-37, T-cell surface antigen T11/Leu-5, CD_antigen= CD2

UniProt

P08920

Expression Region

23-344

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKDEELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG7 Rabbit Polyclonal Antibody (Fluoro488)
orb3118882 100 µg

ATG7 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
CA6 (Carbonic Anhydrase VI, CA-VI, CAVI, GUSTIN, Carbonate dehydratase VI, Salivary carbonic anhydrase, Secreted carbonic anhydrase)
362361 200 µL

CA6 (Carbonic Anhydrase VI, CA-VI, CAVI, GUSTIN, Carbonate dehydratase VI, Salivary carbonic anhydrase, Secreted carbonic anhydrase)

Sign In for Pricing
View Details
ZNF498 3'UTR GFP Stable Cell Line
TU079212 1.0 mL

ZNF498 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ADAMDEC1 Antibody, FITC conjugated
CSB-PA001297LC01HU-01 50 µg

ADAMDEC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ADAMDEC1 Antibody, FITC conjugated
CSB-PA001297LC01HU-02 100 µg

ADAMDEC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Brain Derived Neurotrophic Factor (BDNF), Recombinant, Human, His-Tag, SUMO-Tag
058125-01 10 µg

Brain Derived Neurotrophic Factor (BDNF), Recombinant, Human, His-Tag, SUMO-Tag

Sign In for Pricing
View Details