Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipid scramblase 4 (Plscr4)

This Recombinant Mouse Phospholipid scramblase 4 (Plscr4) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Phospholipid scramblase 4, PL scramblase 4, Ca (2+) -dependent phospholipid scramblase 4

UniProt

P58196

Expression Region

1-326

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPVASPSAGLPMGYYIPQQPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLSTMVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Thymidine phosphorylase ELISA kit
GTR10441308 96 Well

Rabbit Thymidine phosphorylase ELISA kit

Sign In for Pricing
View Details
SEZ6L2 Rabbit pAb
MBS9146116-01 0.02 mL

SEZ6L2 Rabbit pAb

Sign In for Pricing
View Details
SEZ6L2 Rabbit pAb
MBS9146116-02 0.1 mL

SEZ6L2 Rabbit pAb

Sign In for Pricing
View Details
SEZ6L2 Rabbit pAb
MBS9146116-03 5x 0.1 mL

SEZ6L2 Rabbit pAb

Sign In for Pricing
View Details
Canine Mucin 3 ELISA Kit
MBS059614-01 48 Well

Canine Mucin 3 ELISA Kit

Sign In for Pricing
View Details
Canine Mucin 3 ELISA Kit
MBS059614-02 96 Well

Canine Mucin 3 ELISA Kit

Sign In for Pricing
View Details