Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Type 2 lactosamine alpha-2,3-sialyltransferase (St3gal6)

This Recombinant Rat Type 2 lactosamine alpha-2,3-sialyltransferase (St3gal6) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Type 2 lactosamine alpha-2,3-sialyltransferase, EC= 2.4.99.-, CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI, ST3Gal VI, ST3GalVI, Sialyltransferase 10

UniProt

P61943

Expression Region

1-331

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSGLSKLQSCDLVGQFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), 0.2mg/mL
BNUB0266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), 0.2mg/mL

Sign In for Pricing
View Details