Recombinant Rat CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (St3gal4)

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, EC= 2.4.99.-, Alpha 2,3-sialyltransferase IV, Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, ST3Gal IV, ST3GalIV, Sialyltransferase 4C, SIAT4-C

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPVSEKKEPCFQGEAERQASKIFGNHSREQPIFLQLKDYFWVKTPSAYELPFGTKGSEDLLLRVLAITSYSIPESIQSLECRRCVVVGNGHRLKNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEAVAIKRMLEMGAVKNLTYF