Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hematopoietic progenitor cell antigen CD34 (CD34)

This Recombinant Human Hematopoietic progenitor cell antigen CD34 (CD34) spans the amino acid sequence from region 32-385.

Product Specifications

Product Name Alternative

Hematopoietic progenitor cell antigen CD34, CD_antigen= CD34

UniProt

P28906

Expression Region

32-385

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-100 1x 100 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details