Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein phosphatase 1L (PPM1L)

This Recombinant Bovine Protein phosphatase 1L (PPM1L) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Protein phosphatase 1L, EC= 3.1.3.16, Protein phosphatase 1-like, Protein phosphatase 2C isoform epsilon, PP2C-epsilon

UniProt

A5PJZ2

Expression Region

1-360

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLMDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKDRLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Bismuthate (>80%)
TRC-S614600-50G 50 g

Sodium Bismuthate (>80%)

Sign In for Pricing
View Details
Vmn1r42 Mouse Gene Knockout Kit (CRISPR)
KN519055 1 Kit

Vmn1r42 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS621003 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Cdh4 Mouse Gene Knockout Kit (CRISPR)
KN503014 1 Kit

Cdh4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAT Antibody
KC-7571-01 50 μL

CAT Antibody

Sign In for Pricing
View Details
CAT Antibody
KC-7571-02 100 µL

CAT Antibody

Sign In for Pricing
View Details