Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-sarcoglycan (Sgca)

This Recombinant Mouse Alpha-sarcoglycan (Sgca) spans the amino acid sequence from region 24-387.

Product Specifications

Product Name Alternative

Alpha-sarcoglycan, Alpha-SG, 50 kDa dystrophin-associated glycoprotein, 50DAG, Adhalin

UniProt

P82350

Expression Region

24-387

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIEVTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flutianil
orb1697180 25 mg

Flutianil

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Undecaprenyl-phosphate galactose phosphotransferase (rfbP)
orb2914111-01 20 µg

Recombinant Salmonella typhimurium Undecaprenyl-phosphate galactose phosphotransferase (rfbP)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Undecaprenyl-phosphate galactose phosphotransferase (rfbP)
orb2914111-02 100 µg

Recombinant Salmonella typhimurium Undecaprenyl-phosphate galactose phosphotransferase (rfbP)

Sign In for Pricing
View Details
Palbociclib Impurity 113
RM-P020413-01 10 mg

Palbociclib Impurity 113

Sign In for Pricing
View Details
Palbociclib Impurity 113
RM-P020413-02 25 mg

Palbociclib Impurity 113

Sign In for Pricing
View Details
Palbociclib Impurity 113
RM-P020413-03 50 mg

Palbociclib Impurity 113

Sign In for Pricing
View Details