Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-sarcoglycan (Sgca)

This Recombinant Mouse Alpha-sarcoglycan (Sgca) spans the amino acid sequence from region 24-387.

Product Specifications

Product Name Alternative

Alpha-sarcoglycan, Alpha-SG, 50 kDa dystrophin-associated glycoprotein, 50DAG, Adhalin

UniProt

P82350

Expression Region

24-387

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIEVTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (3-Methoxyoxetan-3-yl) benzoic acid
RPD13830-01 50 mg

3- (3-Methoxyoxetan-3-yl) benzoic acid

Sign In for Pricing
View Details
3- (3-Methoxyoxetan-3-yl) benzoic acid
RPD13830-02 0.5 g

3- (3-Methoxyoxetan-3-yl) benzoic acid

Sign In for Pricing
View Details
Olfr641 Protein Vector (Mouse) (pPM-C-HA)
PV211184 500 ng

Olfr641 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Angiomotin-like protein 1 ELISA Kit
MBS2883492-01 48 Well

Human Angiomotin-like protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Angiomotin-like protein 1 ELISA Kit
MBS2883492-02 96 Well

Human Angiomotin-like protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Angiomotin-like protein 1 ELISA Kit
MBS2883492-03 5x 96 Well

Human Angiomotin-like protein 1 ELISA Kit

Sign In for Pricing
View Details