Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-sarcoglycan (Sgca)

This Recombinant Mouse Alpha-sarcoglycan (Sgca) spans the amino acid sequence from region 24-387.

Product Specifications

Product Name Alternative

Alpha-sarcoglycan, Alpha-SG, 50 kDa dystrophin-associated glycoprotein, 50DAG, Adhalin

UniProt

P82350

Expression Region

24-387

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIEVTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA6 Rabbit Polyclonal Antibody (HRP)
orb2139690 100 µL

GATA6 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Alpha 3 ELISA Kit
MBS069796-01 48 Well

Mouse Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Alpha 3 ELISA Kit
MBS069796-02 96 Well

Mouse Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Alpha 3 ELISA Kit
MBS069796-03 5x 96 Well

Mouse Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione S Transferase Alpha 3 ELISA Kit
MBS069796-04 10x 96 Well

Mouse Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Α-2B adrenergic Receptor (ADRA2B) Horse ELISA Kit
B4031 96 Tests

Α-2B adrenergic Receptor (ADRA2B) Horse ELISA Kit

Sign In for Pricing
View Details