Recombinant Human Beta-1,4-galactosyltransferase 2 (B4GALT2)

Beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, Beta4Gal-T2, b4Gal-T2, EC= 2.4.1.-, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2, Including the following 4 domains:, Lactose synthase A protein, EC= 2.4.1.22, N-acetyllactosamine synthase, EC= 2.4.1.90, Nal synthase, Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase, EC= 2.4.1.38, Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase, EC= 2.4.1.-

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG