Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-3 receptor subunit alpha (Il3ra)

This Recombinant Mouse Interleukin-3 receptor subunit alpha (Il3ra) spans the amino acid sequence from region 17-396.

Product Specifications

Product Name Alternative

Interleukin-3 receptor subunit alpha, IL-3 receptor subunit alpha, IL-3R subunit alpha, IL-3R-alpha, IL-3RA, Interleukin-3 receptor class II alpha chain, CD_antigen= CD123

UniProt

P26952

Expression Region

17-396

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLLYRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG12 Antibody
orb252472 100 µL

ATG12 Antibody

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit
MBS059194-01 48 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit
MBS059194-02 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit
MBS059194-03 5x 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit
MBS059194-04 10x 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 7 ELISA Kit

Sign In for Pricing
View Details
Beclin-1 Antibody
MBS151201-01 0.1 mg

Beclin-1 Antibody

Sign In for Pricing
View Details