Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein CASC4 (CASC4)

This Recombinant Bovine Protein CASC4 (CASC4) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Protein CASC4, Cancer susceptibility candidate gene 4 protein homolog

UniProt

A2VE10

Expression Region

1-380

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFGANRRAGRLPSLVLAVLLVVIAVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDSHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQIKELRAQHEENIKKLADQFLQEQKQEAHKFESKGGNELDTDNHAVPKNIPEVAENGAGKNEEPSSHHIPHGKEQIKRGGDAGMPGIEENDLAKAEDVPVALKKPPVSFSQYESHQVISHLPTGQPLSPNMVPDSHINHNGNSRTSKQNPSNPLQRLIPGPNLENEPRIQAEVLKQATKDRAGDFHKLKQNDEERELQMDPADYGKQRFNDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)
MBS6300193-01 0.2 mL

FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)

Sign In for Pricing
View Details
FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)
MBS6300193-02 5x 0.2 mL

FSCN3, CT (FSCN3, Fascin-3, Testis fascin) (Biotin)

Sign In for Pricing
View Details
Recombinant Human RALGPS1 Protein - (Dry Ice)
H00009649-P01-10ug 10 µg

Recombinant Human RALGPS1 Protein - (Dry Ice)

Sign In for Pricing
View Details
XKRY2 3'UTR Lenti-reporter-Luc Vector
50532081 1.0 µg

XKRY2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit Monoclonal TLR2 Antibody (TL2.1) [Janelia Fluor 549]
NBP3-12062JF549 0.1 mL

Rabbit Monoclonal TLR2 Antibody (TL2.1) [Janelia Fluor 549]

Sign In for Pricing
View Details
Fgf9 (NM_012952) Rat Untagged Clone
RN211547 10 µg

Fgf9 (NM_012952) Rat Untagged Clone

Sign In for Pricing
View Details