Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein CASC4 (CASC4)

This Recombinant Bovine Protein CASC4 (CASC4) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Protein CASC4, Cancer susceptibility candidate gene 4 protein homolog

UniProt

A2VE10

Expression Region

1-380

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFGANRRAGRLPSLVLAVLLVVIAVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDSHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQIKELRAQHEENIKKLADQFLQEQKQEAHKFESKGGNELDTDNHAVPKNIPEVAENGAGKNEEPSSHHIPHGKEQIKRGGDAGMPGIEENDLAKAEDVPVALKKPPVSFSQYESHQVISHLPTGQPLSPNMVPDSHINHNGNSRTSKQNPSNPLQRLIPGPNLENEPRIQAEVLKQATKDRAGDFHKLKQNDEERELQMDPADYGKQRFNDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK2 CRISPR Activation Plasmid (m)
sc-430660-ACT 20 µg

DLK2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
ATP6AP1 (h4) : 293T Lysate
sc-175196 100 µg - 200 µL

ATP6AP1 (h4) : 293T Lysate

Sign In for Pricing
View Details
CEECAM1 (CERCAM) Human shRNA Plasmid Kit (Locus ID 51148)
TL305455 1 Kit

CEECAM1 (CERCAM) Human shRNA Plasmid Kit (Locus ID 51148)

Sign In for Pricing
View Details
Vsig4 ORF Vector (Mouse) (pORF)
50207014 1.0 µg DNA

Vsig4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Fluor594-conjugated Polyclonal Rabbit Anti-Rat IgG (H+L) Secondary Antibody
APS0388-01 200 µL

Fluor594-conjugated Polyclonal Rabbit Anti-Rat IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Fluor594-conjugated Polyclonal Rabbit Anti-Rat IgG (H+L) Secondary Antibody
APS0388-02 500 µL

Fluor594-conjugated Polyclonal Rabbit Anti-Rat IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details