Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein CASC4 (CASC4)

This Recombinant Bovine Protein CASC4 (CASC4) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Protein CASC4, Cancer susceptibility candidate gene 4 protein homolog

UniProt

A2VE10

Expression Region

1-380

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFGANRRAGRLPSLVLAVLLVVIAVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDSHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQIKELRAQHEENIKKLADQFLQEQKQEAHKFESKGGNELDTDNHAVPKNIPEVAENGAGKNEEPSSHHIPHGKEQIKRGGDAGMPGIEENDLAKAEDVPVALKKPPVSFSQYESHQVISHLPTGQPLSPNMVPDSHINHNGNSRTSKQNPSNPLQRLIPGPNLENEPRIQAEVLKQATKDRAGDFHKLKQNDEERELQMDPADYGKQRFNDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51 (NM_002875) Human Over-expression Lysate
LY419044 100 µg

RAD51 (NM_002875) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal CD34 Antibody (QBEnd/10 + HPCA1/763) [mFluor Violet 450 SE]
NBP2-47909MFV450 0.1 mL

Mouse Monoclonal CD34 Antibody (QBEnd/10 + HPCA1/763) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Eda2r (NM_001161432) Mouse Tagged ORF Clone Lentiviral Particle
MR222258L3V 200 µL

Eda2r (NM_001161432) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Mouse FNDC3A (KIAA0970), Rabbit Polyclonal
MKA0970 Inquire

Anti-Mouse FNDC3A (KIAA0970), Rabbit Polyclonal

Sign In for Pricing
View Details
SETD8 Antibody (Center)
MBS9201140-01 0.08 mL

SETD8 Antibody (Center)

Sign In for Pricing
View Details
SETD8 Antibody (Center)
MBS9201140-02 0.4 mL

SETD8 Antibody (Center)

Sign In for Pricing
View Details