Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Estradiol 17-beta-dehydrogenase 2 (Hsd17b2)

This Recombinant Mouse Estradiol 17-beta-dehydrogenase 2 (Hsd17b2) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Estradiol 17-beta-dehydrogenase 2, EC= 1.1.1.62, 17-beta-hydroxysteroid dehydrogenase type 2, 17-beta-HSD 2, Testosterone 17-beta-dehydrogenase, EC= 1.1.1.63

UniProt

P51658

Expression Region

1-381

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPFASESAWLCLAAAAVLGGTLLCGCRSGRQLRSQAVCLAGLWGGACLLSLSLLCTLFLLSVACFLLLYMSSSDQDLLPVDQKAVLVTGADSGFGHGLAKHLDKLGFTVFAGVLDKEGPGAEELRKHCSERLSVLQMDVTKPEQIKDAHSKVTEKIQDKGLWAVVNNAGVFHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRKSKGRLVNVSSMGGTVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNITGSQDIWDKMEKEILDHFSKDIQENYGQDYVHTQKLIIPTLKERSNPDITPVLRDIQHAISARNPSSFYYPGRMAYLWVCLAAYCPTSLLDYVIKKGFYPQPTPRALRTVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r105 Mouse Gene Knockout Kit (CRISPR)
KN519119 1 Kit

Vmn2r105 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycerol 1-Oleyl Ether
TRC-G598710-200MG 200 mg

Glycerol 1-Oleyl Ether

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF640R conjugate, 0.1mg/mL
BNC402231-100 1x 100 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAD51 Antibody
KC-1286-01 50 μL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1286-02 100 µL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1286-03 1 mL

RAD51 Antibody

Sign In for Pricing
View Details