Recombinant Chlorocebus aethiops CD209 antigen (CD209)
This Recombinant Chlorocebus aethiops CD209 antigen (CD209) spans the amino acid sequence from region 1-381.
Product Specifications
Product Name Alternative
CD209 antigen, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN1, CD_antigen= CD209
UniProt
P60883
Expression Region
1-381
Origin
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSQLKAAVGDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVERLCRPCPWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNIGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPTPTTPNPPPE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
