Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptotagmin-5 (Syt5)

This Recombinant Rat Synaptotagmin-5 (Syt5) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Synaptotagmin-5, Synaptotagmin IX, Synaptotagmin V, SytV

UniProt

P47861

Expression Region

1-386

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFPEPPTPGSPAPETPPDSSRIRQGAVPAWVLATILLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDPSPSMPGQQVLDKHQLGRLQYSLDYDFQTGQLLVGILQAEGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGTAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Oligophrenin-1 (OPHN1) ELISA Kit
abx390109 96 Tests

Mouse Oligophrenin-1 (OPHN1) ELISA Kit

Sign In for Pricing
View Details
Foxp3 3'UTR Lenti-reporter-Luc Vector
20798084 1.0 µg

Foxp3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TMEM38A Rabbit Polyclonal Antibody
orb631975-01 50 µg

TMEM38A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM38A Rabbit Polyclonal Antibody
orb631975-02 100 µg

TMEM38A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYT17 Rabbit pAb (APR25592N)
APR25592N-01 50 µL

SYT17 Rabbit pAb (APR25592N)

Sign In for Pricing
View Details
SYT17 Rabbit pAb (APR25592N)
APR25592N-02 100 µL

SYT17 Rabbit pAb (APR25592N)

Sign In for Pricing
View Details