Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysosomal acid phosphatase (ACP2)

This Recombinant Human Lysosomal acid phosphatase (ACP2) spans the amino acid sequence from region 31-423.

Product Specifications

Product Name Alternative

Lysosomal acid phosphatase, LAP, EC= 3.1.3.2

UniProt

P11117

Expression Region

31-423

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRLTEPVVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYRHVADGEDHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAPP1 (Ab-139) Antibody
8B0901-AAT 50 µg

DAPP1 (Ab-139) Antibody

Sign In for Pricing
View Details
pan Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM115 + SPM116]
AM33270PU-S 100 µg

pan Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM115 + SPM116]

Sign In for Pricing
View Details
PINLYP (NM_001193621) Human Over-expression Lysate
LC434074 20 µg

PINLYP (NM_001193621) Human Over-expression Lysate

Sign In for Pricing
View Details
Scaf11 Mouse Gene Knockout Kit (CRISPR)
KN515329 1 Kit

Scaf11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL) Polyclonal Antibody
E-AB-93077-01 60 µL

Alkaline Phosphatase (ALPL) Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL) Polyclonal Antibody
E-AB-93077-02 120 µL

Alkaline Phosphatase (ALPL) Polyclonal Antibody

Sign In for Pricing
View Details