Recombinant Human Beta-1,4-galactosyltransferase 1 (B4GALT1)

Beta-1,4-galactosyltransferase 1 Beta-1,4-GalTase 1 Beta4Gal-T1 b4Gal-T1 EC= 2.4.1.- UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1 UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1Cleaved into the following chain: 1. Processed beta-1,4-galactosyltransferase 1 2. Including the following 4 domains: 3. Lactose synthase A protein EC= 4. 2.4.1.22 5. N-acetyllactosamine synthase EC= 6. 2.4.1.90 Nal synthase Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase EC= 2.4.1.38 Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase EC= 2.4.1.-

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS