Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Synaptotagmin-1 (SYT1)

This Recombinant Chicken Synaptotagmin-1 (SYT1) spans the amino acid sequence from region 1-424.

Product Specifications

Product Name Alternative

Synaptotagmin-1, Synaptotagmin I, SytI, p65

UniProt

P47191

Expression Region

1-424

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSESHHEALAAPPATTVAAALPSNVTEPAAPGGGGGKEDAFSNLKKKFMNELNKIPLPPWALIAIAIVAVLLILTCCFCLCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQPEEEVDAMLAVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Topoisomerase I, MT (TOP1MT/488), CF568 conjugate, 0.1mg/mL
BNC680488-500 1x 500 µL

Topoisomerase I, MT (TOP1MT/488), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human USP54 activation kit by CRISPRa
GA115988 1 Kit

Human USP54 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Sas-6 protein (His tag)
PDEH101029-01 20 µg

Recombinant Human Sas-6 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Sas-6 protein (His tag)
PDEH101029-02 100 µg

Recombinant Human Sas-6 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Sas-6 protein (His tag)
PDEH101029-03 500 µg

Recombinant Human Sas-6 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Sas-6 protein (His tag)
PDEH101029-04 1 mg

Recombinant Human Sas-6 protein (His tag)

Sign In for Pricing
View Details