Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5)

This Recombinant Bovine Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5) spans the amino acid sequence from region 1-432.

Product Specifications

Product Name Alternative

Ectonucleoside triphosphate diphosphohydrolase 5, NTPDase 5, EC= 3.6.1.6, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, EC= 3.6.1.42, Uridine-diphosphatase ENTPD5, UDPase ENTPD5

UniProt

E1BPW0

Expression Region

1-432

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALYQGAAFFMLVASCVCSTVFHREQQTWFEGVFLSSMCPVNVSAGTLYGIMFDAGSTGTRIHVYTFVQKVPDNTGQLPVLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPPSHWKRTPVVLKATAGLRLLPEEKAEALLFEVKEIFKKSPFLVPDDSVSIMDGSYEGILAWVTVNFLTGQLHGHNQETVGTLDLGGASTQITFLPQFEKTLEQTPRDYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETAGIDGYTFRSACLPRWLEAEWIFGGVKYQYGGNQEAGEVGFEPCYAEVLRVVQGKLHQPDEVQRGSFYAFSYYYDRAVDTDMIDYEKGGVLKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFASSTVLQLTKKVNNIETGWALGATFHLLQSLGISH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR3 Protein Vector (Human) (pPB-C-His)
PV016673 500 ng

FPR3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Shigella sonnei UPF0266 membrane protein yobD (yobD)
MBS7035297-01 0.02 mg

Recombinant Shigella sonnei UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Recombinant Shigella sonnei UPF0266 membrane protein yobD (yobD)
MBS7035297-02 0.1 mg

Recombinant Shigella sonnei UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Recombinant Shigella sonnei UPF0266 membrane protein yobD (yobD)
MBS7035297-03 5x 0.1 mg

Recombinant Shigella sonnei UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Chicken Gamma glutamyl transferase (GGT) ELISA Kit
CK-bio-24315-01 48 Tests

Chicken Gamma glutamyl transferase (GGT) ELISA Kit

Sign In for Pricing
View Details
Chicken Gamma glutamyl transferase (GGT) ELISA Kit
CK-bio-24315-02 96 Tests

Chicken Gamma glutamyl transferase (GGT) ELISA Kit

Sign In for Pricing
View Details