Recombinant Ailuropoda melanoleuca Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5)

Ectonucleoside triphosphate diphosphohydrolase 5, NTPDase 5, EC= 3.6.1.6, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, EC= 3.6.1.42, Uridine-diphosphatase ENTPD5, UDPase ENTPD5

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MATTWGAAFFMLVASCVCSTVFHRDQQTWFEGVFLSSMCPINVSASTLYGIMFDAGSTGTRIHIYTFVQKIPGQLPILEGEIFESVKPGLSAFVDQPKQGAETVEELLEVAKDSVPRSHWKRTPVVLKATAGLRLLPEQKAEALLFEVREIFRKSPFLVPDDSVSIMDGSYEGILAWVTVNFLTGQLHGHSQKTVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGIDGHTFRSACLPRWLEAEWIFGGVKYQYGGNKEGNEGSGEVGFEPCYAEVLRVVQGKLHQPDEVRKSSFYAFSYYYDRAADTDMIDYETGGVLKVEDFERKAREVCDNLEKFTSGSPFLCMDLSYITALLKDGFGFADSTILQLSKKVNNIETGWALGATFHLLQSLGISH