Recombinant Rabbit Zona pellucida sperm-binding protein 4 (ZP4)
This Recombinant Rabbit Zona pellucida sperm-binding protein 4 (ZP4) spans the amino acid sequence from region 25-466.
Product Specifications
Product Name Alternative
Zona pellucida sperm-binding protein 4, RC55, Zona pellucida glycoprotein 4, Zp-4, Zona pellucida glycoprotein X, Zp-X, Zona pellucida protein B, Cleaved into the following chain:, 1. Processed zona pellucida sperm-binding protein 4
UniProt
Q00193
Expression Region
25-466
Origin
Oryctolagus cuniculus (Rabbit)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
KQPKPETPTDPGVLHCRPWNFKFTINFQNQETGSSPVLVTWDNQGRLHRLQNDTDCGTRVGEGPGPSVVLEANYSSCYVTESEPYYVMLVGVEEVDAAGQNLVTKQQLLKCPMHLPAPDAGLCDSVPVQDRLPCATAPISQEDCEELGCCHSSEEVNACYYGNTVTSHCTQEGHFSIAVSRNVSSPPLHLDSVHLVFGNDSECQPVVATRAFVLFLFPFTACGTTRQITGDRAIYENELLATREVRTWSRGSITRDSIFRLRVSCSYSISSSALPVDMHVLTLPPPLPETQPGPLTVVLQIAKDKDYHSYYTMDDYPVVKLLRDPIYVDVSILYRTDPYLGLRLHQCWATPRTNPLYQPQWPILVKGCPYTGDNYQTQLIPVQEAFDLPFPSHHQRFSISTFSFLDSSVAKEALKGPIYLHCSVSVCQPTGTQSCTVTCPIDSRRRNSDINFQNSTANISSKGPMI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog