Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 3 (TMPRSS3)

This Recombinant Human Transmembrane protease serine 3 (TMPRSS3) spans the amino acid sequence from region 1-454.

Product Specifications

Product Name Alternative

Transmembrane protease serine 3, EC= 3.4.21.-, Serine protease TADG-12, Tumor-associated differentially-expressed gene 12 protein

UniProt

P57727

Expression Region

1-454

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-sec-Butyl-5-[3- (morpholine-4-sulfonyl) -phenyl]-4H-[1,2,4]triazole-3-thiol
sc-349729A 5 g

4-sec-Butyl-5-[3- (morpholine-4-sulfonyl) -phenyl]-4H-[1,2,4]triazole-3-thiol

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)
MBS1364254-01 0.02 mg (E-Coli)

Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)
MBS1364254-02 0.02 mg (Yeast)

Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)
MBS1364254-03 0.1 mg (E-Coli)

Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)
MBS1364254-04 0.1 mg (Yeast)

Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)
MBS1364254-05 0.02 mg (Baculovirus)

Recombinant Clostridium perfringens Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details