Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5)

This Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5) spans the amino acid sequence from region 24-494.

Product Specifications

Product Name Alternative

T-cell surface glycoprotein CD5, Lymphocyte antigen 1, Ly-1, Lyt-1, CD_antigen= CD5

UniProt

P13379

Expression Region

24-494

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNPAGLAPGTVASIILTLVLLVVLLAMCGPLVYKKLVKKFRQKKQRQWIGPTGVNQNMSFHRSHTATVRSQVENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Factor X Rabbit Monoclonal Antibody , Carrier-free
M00641-1-carrier-free 100 µL

Anti-Factor X Rabbit Monoclonal Antibody , Carrier-free

Sign In for Pricing
View Details
COX-1-IN-1
orb2566603-01 50 mg

COX-1-IN-1

Sign In for Pricing
View Details
COX-1-IN-1
orb2566603-02 10 mg

COX-1-IN-1

Sign In for Pricing
View Details
Anti-Human KRT8/CK-8 Antibody (TS1)
MBS1569192-01 0.1 mg

Anti-Human KRT8/CK-8 Antibody (TS1)

Sign In for Pricing
View Details
Anti-Human KRT8/CK-8 Antibody (TS1)
MBS1569192-02 1 mg

Anti-Human KRT8/CK-8 Antibody (TS1)

Sign In for Pricing
View Details
Anti-Human KRT8/CK-8 Antibody (TS1)
MBS1569192-03 5x 1 mg

Anti-Human KRT8/CK-8 Antibody (TS1)

Sign In for Pricing
View Details