Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5)

This Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5) spans the amino acid sequence from region 24-494.

Product Specifications

Product Name Alternative

T-cell surface glycoprotein CD5, Lymphocyte antigen 1, Ly-1, Lyt-1, CD_antigen= CD5

UniProt

P13379

Expression Region

24-494

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNPAGLAPGTVASIILTLVLLVVLLAMCGPLVYKKLVKKFRQKKQRQWIGPTGVNQNMSFHRSHTATVRSQVENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human UBE2M sgRNA gene knockout kit - Lentiviral human UBE2M sgRNA gene knockout kit (plasmid)
GTR15365669 1 Vial

Lentiviral human UBE2M sgRNA gene knockout kit - Lentiviral human UBE2M sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ALDH6A1 siRNA (Rat)
MBS8207084-01 15 nmol

ALDH6A1 siRNA (Rat)

Sign In for Pricing
View Details
ALDH6A1 siRNA (Rat)
MBS8207084-02 30 nmol

ALDH6A1 siRNA (Rat)

Sign In for Pricing
View Details
ALDH6A1 siRNA (Rat)
MBS8207084-03 5x 30 nmol

ALDH6A1 siRNA (Rat)

Sign In for Pricing
View Details
FXR2 peptide
orb218261-01 1 mg

FXR2 peptide

Sign In for Pricing
View Details
FXR2 peptide
orb218261-02 5 mg

FXR2 peptide

Sign In for Pricing
View Details