Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD5 (CD5)

This Recombinant Human T-cell surface glycoprotein CD5 (CD5) spans the amino acid sequence from region 25-495.

Product Specifications

Product Name Alternative

T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD_antigen= CD5

UniProt

P06127

Expression Region

25-495

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-KLHL3 Antibody
MBS4513777-01 0.05 mL

Rabbit anti-KLHL3 Antibody

Sign In for Pricing
View Details
Rabbit anti-KLHL3 Antibody
MBS4513777-02 0.1 mL

Rabbit anti-KLHL3 Antibody

Sign In for Pricing
View Details
Rabbit anti-KLHL3 Antibody
MBS4513777-03 5x 0.1 mL

Rabbit anti-KLHL3 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fgf9 shRNA (UAS) - Lentiviral mouse Fgf9 shRNA (UAS, GFP) (100)
GTR15244197 1 Vial

Lentiviral mouse Fgf9 shRNA (UAS) - Lentiviral mouse Fgf9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Sulfo-Cyanine7 dicarboxylic acid, 25 mg
1497-25mg 25 mg

Sulfo-Cyanine7 dicarboxylic acid, 25 mg

Sign In for Pricing
View Details
Phospho-c-Raf (Ser296) Antibody Blocking Peptide
orb1505137 500 µg

Phospho-c-Raf (Ser296) Antibody Blocking Peptide

Sign In for Pricing
View Details