Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 1 (NPY1R)

This Recombinant Human Neuropeptide Y receptor type 1 (NPY1R) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 1 NPY1-R

UniProt

P25929

Expression Region

1-384

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM12 Human Over-expression Lysate
orb1370663 20 µg

ADAM12 Human Over-expression Lysate

Sign In for Pricing
View Details
ARHGAP42
552446 100 µL

ARHGAP42

Sign In for Pricing
View Details
GABAA Rθ siRNA (m)
sc-155896 10 µM

GABAA Rθ siRNA (m)

Sign In for Pricing
View Details
Rifamycin S
S4425-25mg 25 mg

Rifamycin S

Sign In for Pricing
View Details
Recombinant Mouse SULT1A1
P5356-01 50 µg

Recombinant Mouse SULT1A1

Sign In for Pricing
View Details
Recombinant Mouse SULT1A1
P5356-02 200 µg

Recombinant Mouse SULT1A1

Sign In for Pricing
View Details