Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (2) dopamine receptor (DRD2)

This Recombinant Human D (2) dopamine receptor (DRD2) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

D (2) dopamine receptor Dopamine D2 receptor

UniProt

P14416

Expression Region

1-443

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK3
CSB-CL012454HU1 10 μg Plasmid + 200 μL Glycerol

KLK3

Sign In for Pricing
View Details
HLADQ antibody
10R-8138 0.1 mg

HLADQ antibody

Sign In for Pricing
View Details
Tmem206 (NM_001007679) Rat Tagged ORF Clone Lentiviral Particle
RR204692L4V 200 µL

Tmem206 (NM_001007679) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PISD Antibody
MBS8504451-01 0.1 mg

PISD Antibody

Sign In for Pricing
View Details
PISD Antibody
MBS8504451-02 0.1 mL (AF405L)

PISD Antibody

Sign In for Pricing
View Details
PISD Antibody
MBS8504451-03 0.1 mL (AF405S)

PISD Antibody

Sign In for Pricing
View Details