Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (2) dopamine receptor (DRD2)

This Recombinant Human D (2) dopamine receptor (DRD2) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

D (2) dopamine receptor Dopamine D2 receptor

UniProt

P14416

Expression Region

1-443

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL3RA Antibody Picoband®, Dylight594 Conjugate
PA1617-Dylight594 100 µg

Anti-IL3RA Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Anti-Tubulin beta antibody
STJ96145 200 µl

Anti-Tubulin beta antibody

Sign In for Pricing
View Details
KCNQ3 Conjugated Antibody
orb1616612 100 µL

KCNQ3 Conjugated Antibody

Sign In for Pricing
View Details
Vmn1r80 Mouse Gene Knockout Kit (CRISPR)
KN519097 1 Kit

Vmn1r80 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chicken Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit
MBS2610739-01 48 Well

Chicken Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit

Sign In for Pricing
View Details
Chicken Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit
MBS2610739-02 96 Well

Chicken Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit

Sign In for Pricing
View Details