Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-2A adrenergic receptor (Adra2a)

This Recombinant Rat Alpha-2A adrenergic receptor (Adra2a) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Alpha-2A adrenergic receptor Alpha-2A adrenoreceptor Alpha-2A adrenoceptor Alpha-2AAR Alpha-2D adrenergic receptor CA2-47

UniProt

P22909

Expression Region

1-450

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-JOE acid
204-AAT 10 mg

6-JOE acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS800465 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
2-Ethylbenzofuran
TRC-E899770-5G 5 g

2-Ethylbenzofuran

Sign In for Pricing
View Details
GPR83 (NM_016540) Human Over-expression Lysate
LY402564 100 µg

GPR83 (NM_016540) Human Over-expression Lysate

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF594 conjugate, 0.1mg/mL
BNC941830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Amino-4-bromo-5-phenylpyrazole
TRC-A601835-2.5G 2.5 g

3-Amino-4-bromo-5-phenylpyrazole

Sign In for Pricing
View Details