Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-2A adrenergic receptor (Adra2a)

This Recombinant Rat Alpha-2A adrenergic receptor (Adra2a) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Alpha-2A adrenergic receptor Alpha-2A adrenoreceptor Alpha-2A adrenoceptor Alpha-2AAR Alpha-2D adrenergic receptor CA2-47

UniProt

P22909

Expression Region

1-450

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zpld1 Pre-designed siRNA Set B
SI116622B 1 Each

Mouse Zpld1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
OR52B6 Conjugated Antibody
orb1616081 100 µL

OR52B6 Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Rat BUD13 homolog (Bud13)
MBS1483258-01 0.02 mg (E-Coli)

Recombinant Rat BUD13 homolog (Bud13)

Sign In for Pricing
View Details
Recombinant Rat BUD13 homolog (Bud13)
MBS1483258-02 0.02 mg (Yeast)

Recombinant Rat BUD13 homolog (Bud13)

Sign In for Pricing
View Details
Recombinant Rat BUD13 homolog (Bud13)
MBS1483258-03 0.1 mg (E-Coli)

Recombinant Rat BUD13 homolog (Bud13)

Sign In for Pricing
View Details
Recombinant Rat BUD13 homolog (Bud13)
MBS1483258-04 0.1 mg (Yeast)

Recombinant Rat BUD13 homolog (Bud13)

Sign In for Pricing
View Details