Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-2A adrenergic receptor (Adra2a)

This Recombinant Rat Alpha-2A adrenergic receptor (Adra2a) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Alpha-2A adrenergic receptor Alpha-2A adrenoreceptor Alpha-2A adrenoceptor Alpha-2AAR Alpha-2D adrenergic receptor CA2-47

UniProt

P22909

Expression Region

1-450

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM15 Recombinant Protein Antigen
NBP1-86816PEP 0.1 mL

PRDM15 Recombinant Protein Antigen

Sign In for Pricing
View Details
PABPC4L (NM_001114734) Human Over-expression Lysate
LS132430 100 µg

PABPC4L (NM_001114734) Human Over-expression Lysate

Sign In for Pricing
View Details
CYB5R4 (Cytochrome b5 Reductase 4, Flavohemoprotein b5/b5R, b5+b5R, N-terminal Cytochrome B5 and Cytochrome B5 Oxidoreductase Domain-containing Protein, cb5/cb5R, NCB5OR) (MaxLight 405) discontinued
125529-ML405 100 µL

CYB5R4 (Cytochrome b5 Reductase 4, Flavohemoprotein b5/b5R, b5+b5R, N-terminal Cytochrome B5 and Cytochrome B5 Oxidoreductase Domain-containing Protein, cb5/cb5R, NCB5OR) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SCmL1 (NM_006746) Human Tagged Lenti ORF Clone
RC205262L3 10 µg

SCmL1 (NM_006746) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF647 conjugate, 0.1mg/mL
BNC472560-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LAMP1 Antibody
orb125918-01 25 µg

LAMP1 Antibody

Sign In for Pricing
View Details