Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Frizzled-7 (FZD7)

This Recombinant Chicken Frizzled-7 (FZD7) spans the amino acid sequence from region 32-567.

Product Specifications

Product Name Alternative

Frizzled-7 Fz-7 cFz-7

UniProt

O57329

Expression Region

32-567

Origin

Gallus gallus (Chicken)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AHHEDKAISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATAQPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFKEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAGFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVVACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSTGSKGETAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL
BNC400802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF568 conjugate, 0.1mg/mL
BNC680696-100 1x 100 µL

Cytokeratin 10/13 (DE-K13), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF594 conjugate, 0.1mg/mL
BNC942884-100 1x 100 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details