Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ERGIC-53 (LMAN1)

This Recombinant Human Protein ERGIC-53 (LMAN1) spans the amino acid sequence from region 31-510.

Product Specifications

Product Name Alternative

Protein ERGIC-53, ER-Golgi intermediate compartment 53 kDa protein, Gp58, Intracellular mannose-specific lectin MR60, Lectin mannose-binding 1

UniProt

P49257

Expression Region

31-510

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TAFA-2 Recombinant Protein Lyophilized
MBS8433521-01 0.005 mg

Human TAFA-2 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
Human TAFA-2 Recombinant Protein Lyophilized
MBS8433521-02 5x 0.005 mg

Human TAFA-2 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
HSCB AAV Vector (Rat) (CMV)
23926106 1 µg

HSCB AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
FANK1 Antibody, FITC conjugated
A61553-50UG 50 µg

FANK1 Antibody, FITC conjugated

Sign In for Pricing
View Details
4-Amino-N-(2-ethylphenyl)benzamide
TRC-A640205-500MG 500 mg

4-Amino-N-(2-ethylphenyl)benzamide

Sign In for Pricing
View Details
3-Hydroxy-3-methylindolin-2-one
OR1070481-01 250 mg

3-Hydroxy-3-methylindolin-2-one

Sign In for Pricing
View Details