Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ERGIC-53 (LMAN1)

This Recombinant Human Protein ERGIC-53 (LMAN1) spans the amino acid sequence from region 31-510.

Product Specifications

Product Name Alternative

Protein ERGIC-53, ER-Golgi intermediate compartment 53 kDa protein, Gp58, Intracellular mannose-specific lectin MR60, Lectin mannose-binding 1

UniProt

P49257

Expression Region

31-510

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM160 Antibody - N-terminal region
OAAB19018-400UL 400 µL

TMEM160 Antibody - N-terminal region

Sign In for Pricing
View Details
AST, Recombinant, Rat, His-Tag discontinued
590712-01 20 µg

AST, Recombinant, Rat, His-Tag discontinued

Sign In for Pricing
View Details
AST, Recombinant, Rat, His-Tag discontinued
590712-02 100 µg

AST, Recombinant, Rat, His-Tag discontinued

Sign In for Pricing
View Details
Cxcl12 (NM_013655) Mouse Tagged ORF Clone Lentiviral Particle
MR227229L4V 200 µL

Cxcl12 (NM_013655) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Kv1.8 Polyclonal Antibody
MBS8519755-01 0.1 mg

Kv1.8 Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.8 Polyclonal Antibody
MBS8519755-02 0.1 mL (AF635)

Kv1.8 Polyclonal Antibody

Sign In for Pricing
View Details