Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ERGIC-53 (LMAN1)

This Recombinant Human Protein ERGIC-53 (LMAN1) spans the amino acid sequence from region 31-510.

Product Specifications

Product Name Alternative

Protein ERGIC-53, ER-Golgi intermediate compartment 53 kDa protein, Gp58, Intracellular mannose-specific lectin MR60, Lectin mannose-binding 1

UniProt

P49257

Expression Region

31-510

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rem2 (NM_022685) Rat Tagged ORF Clone
RR203117 10 µg

Rem2 (NM_022685) Rat Tagged ORF Clone

Sign In for Pricing
View Details
CD320, CT (CD320, 8D6A, CD320 antigen, 8D6 antigen, FDC-signaling molecule 8D6, Transcobalamin receptor, CD320) (MaxLight 750) discontinued
033495-ML750 100 µL

CD320, CT (CD320, 8D6A, CD320 antigen, 8D6 antigen, FDC-signaling molecule 8D6, Transcobalamin receptor, CD320) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CENPL Human Over-expression Lysate
orb1351991 100 µg

CENPL Human Over-expression Lysate

Sign In for Pricing
View Details
Acyl-CoA Binding Domain Containing 3 (ACBD3) Antibody
abx338869-01 20 µg

Acyl-CoA Binding Domain Containing 3 (ACBD3) Antibody

Sign In for Pricing
View Details
Acyl-CoA Binding Domain Containing 3 (ACBD3) Antibody
abx338869-02 50 µg

Acyl-CoA Binding Domain Containing 3 (ACBD3) Antibody

Sign In for Pricing
View Details
Acyl-CoA Binding Domain Containing 3 (ACBD3) Antibody
abx338869-03 100 µg

Acyl-CoA Binding Domain Containing 3 (ACBD3) Antibody

Sign In for Pricing
View Details