Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin receptor type-1 (Acvr1)

This Recombinant Mouse Activin receptor type-1 (Acvr1) spans the amino acid sequence from region 21-509.

Product Specifications

Product Name Alternative

Activin receptor type-1, EC= 2.7.11.30, Activin receptor type I, ACTR-I, Serine/threonine-protein kinase receptor R1, SKR1, TGF-B superfamily receptor type I, TSR-I, TSK-7L

UniProt

P37172

Expression Region

21-509

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1810009A15Rik Mouse Gene Knockout Kit (CRISPR)
KN500180 1 Kit

1810009A15Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
[1,2,4]Triazolo[1,5-a]pyridine-6-carboxylic Acid
TRC-T795823-10MG 10 mg

[1,2,4]Triazolo[1,5-a]pyridine-6-carboxylic Acid

Sign In for Pricing
View Details
CD284 / TLR4 (TLR4/230), CF640R conjugate, 0.1mg/mL
BNC400230-500 1x 500 µL

CD284 / TLR4 (TLR4/230), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biocidal ZF
WAK-ZF-1 1 L

Biocidal ZF

Sign In for Pricing
View Details
AHA1 (AHSA1) Rabbit Polyclonal Antibody
AP06790PU-N 100 µg

AHA1 (AHSA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BST2 Rabbit Polyclonal Antibody
TA392425 100 µL

BST2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details