Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin receptor type-1 (Acvr1)

This Recombinant Mouse Activin receptor type-1 (Acvr1) spans the amino acid sequence from region 21-509.

Product Specifications

Product Name Alternative

Activin receptor type-1, EC= 2.7.11.30, Activin receptor type I, ACTR-I, Serine/threonine-protein kinase receptor R1, SKR1, TGF-B superfamily receptor type I, TSR-I, TSK-7L

UniProt

P37172

Expression Region

21-509

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Thyroid gland
CR562797 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
2-Bromo-5-nitropyridine
TRC-B686260-5G 5 g

2-Bromo-5-nitropyridine

Sign In for Pricing
View Details
TAF1 Recombinant Rabbit Monoclonal Antibody [JE40-02]
HA722747 100 µL

TAF1 Recombinant Rabbit Monoclonal Antibody [JE40-02]

Sign In for Pricing
View Details
PTP alpha (PTPRA) (NM_080841) Human Recombinant Protein
TP304392 20 µg

PTP alpha (PTPRA) (NM_080841) Human Recombinant Protein

Sign In for Pricing
View Details
Acrosin (ACR) (Center) Rabbit Polyclonal Antibody
AP50058PU-N 400 µL

Acrosin (ACR) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FAM174A activation kit by CRISPRa
GA117617 1 Kit

Human FAM174A activation kit by CRISPRa

Sign In for Pricing
View Details