Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin receptor type-1 (Acvr1)

This Recombinant Mouse Activin receptor type-1 (Acvr1) spans the amino acid sequence from region 21-509.

Product Specifications

Product Name Alternative

Activin receptor type-1, EC= 2.7.11.30, Activin receptor type I, ACTR-I, Serine/threonine-protein kinase receptor R1, SKR1, TGF-B superfamily receptor type I, TSR-I, TSK-7L

UniProt

P37172

Expression Region

21-509

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvo B19 TaqMan PCR Kit
TM39650 100 Reactions

Parvo B19 TaqMan PCR Kit

Sign In for Pricing
View Details
2’,3’,5’-Tri-O-benzoyl-2-thiouridine
TRC-T771500-250MG 250 mg

2’,3’,5’-Tri-O-benzoyl-2-thiouridine

Sign In for Pricing
View Details
(4R,7S)-Des-(3-amide-N-(tert-butyl)) Tedalinab-3-carboxylic Acid
TRC-D013730-2.5MG 2.5 mg

(4R,7S)-Des-(3-amide-N-(tert-butyl)) Tedalinab-3-carboxylic Acid

Sign In for Pricing
View Details
Malignant T cell amplified sequence 1 (MCTS1) Rabbit Polyclonal Antibody
TA364881 100 µL

Malignant T cell amplified sequence 1 (MCTS1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMPK alpha 1/2 Recombinant Rabbit monoclonal Antibody
HA751251 100 µL

AMPK alpha 1/2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AKR1C1 / AKR1C2 Recombinant Rabbit Monoclonal Antibody [JE33-84]
HA722694 100 µL

AKR1C1 / AKR1C2 Recombinant Rabbit Monoclonal Antibody [JE33-84]

Sign In for Pricing
View Details