Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8)

This Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8) spans the amino acid sequence from region 1-493.

Product Specifications

Product Name Alternative

Ectonucleoside triphosphate diphosphohydrolase 8, E-NTPDase 8, NTPDase 8, NTPDase8, EC= 3.6.1.5, Liver ecto-ATP diphosphohydrolase

UniProt

O93295

Expression Region

1-493

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYKGKVVAGLLTATCVFSIIALILSAVDVKDVFLPPGTKYGLVFDAGSTHTALYVYQWPADKENGTGIVSQVESCTVNGSGISSYADDPAGAGASLKPCLDKAMAVIPVEQQWQTPTYLGATAGMRLLREQNSTKAEQVFAEVSKAIREFPVDFRGAQILTGNEEGSFGWITVNYLLETLIKFSFAGKWEHPQNTEVLGALDLGGASTQITFQPGVTIEDKNTSVLFRLYGTNYSLYTHSYLCYGQIQASKRLMAALHQDGSYVQNISHPCYPKGYRRIITIAEIYDSPCVPTPSMLSPAQILTVTGTGNPAACPTAILKLFNLTCGANRTCGFDGVYQPPVRGQFFAFAGFYYTFSFLNLTGQQSLSHVNATVWDFCNKNWSELVETFPQNKEHLHTYCVVGLYILTLLVDGYKFDEHTWSNIHFSQKAGNADIGWTLGFMLNLTNMIPTEALEHVKGHEPSLWAGAISFIVLAIVAGLVAILLQCFWKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PCSK1 protein
MBS1561275-01 0.05 mg

Recombinant Human PCSK1 protein

Sign In for Pricing
View Details
Recombinant Human PCSK1 protein
MBS1561275-02 0.1 mg

Recombinant Human PCSK1 protein

Sign In for Pricing
View Details
Recombinant Human PCSK1 protein
MBS1561275-03 5x 0.1 mg

Recombinant Human PCSK1 protein

Sign In for Pricing
View Details
IGF1R Monoclonal Antibody
BT-MCA4754-01 50 µL

IGF1R Monoclonal Antibody

Sign In for Pricing
View Details
IGF1R Monoclonal Antibody
BT-MCA4754-02 100 µL

IGF1R Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SPO11 Antibody
NBP2-93056-0.02mL 0.02 mL

Rabbit Polyclonal SPO11 Antibody

Sign In for Pricing
View Details