Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb)

This Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb) spans the amino acid sequence from region 27-537.

Product Specifications

Product Name Alternative

Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, p70-75, CD_antigen= CD122

UniProt

P26896

Expression Region

27-537

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flupyrimin
TRC-F168955-50MG 50 mg

Flupyrimin

Sign In for Pricing
View Details
Goat Interleukin 1 Alpha (IL1a) ELISA Kit
RDR-IL1a-g-01 96 Tests

Goat Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
Goat Interleukin 1 Alpha (IL1a) ELISA Kit
RDR-IL1a-g-02 48 Tests

Goat Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL
BNC471629-500 1x 500 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic anhydrase 2 Recombinant Rabbit monoclonal Antibody
HA750456 100 µL

Carbonic anhydrase 2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD22 Mouse Monoclonal Antibody [Clone ID: OTI1E6]
CF807845 100 µg

CD22 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

Sign In for Pricing
View Details