Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb)

This Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb) spans the amino acid sequence from region 27-537.

Product Specifications

Product Name Alternative

Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, p70-75, CD_antigen= CD122

UniProt

P26896

Expression Region

27-537

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Dicyclohexylphosphino)biphenyl
TRC-D439373-10MG 10 mg

2-(Dicyclohexylphosphino)biphenyl

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF568 conjugate, 0.1mg/mL
BNC680501-100 1x 100 µL

Progesterone Receptor (PR501), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FCF1 Rabbit Polyclonal Antibody
TA376179 100 µL

FCF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS701259 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Thoc3 Mouse Gene Knockout Kit (CRISPR)
KN517533 1 Kit

Thoc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polystyrene C4 OH
HB04508000.5G 5 g

Polystyrene C4 OH

Sign In for Pricing
View Details