Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb)

This Recombinant Rat Interleukin-2 receptor subunit beta (Il2rb) spans the amino acid sequence from region 27-537.

Product Specifications

Product Name Alternative

Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, p70-75, CD_antigen= CD122

UniProt

P26896

Expression Region

27-537

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata24 Mouse Gene Knockout Kit (CRISPR)
KN516549 1 Kit

Spata24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Salbutamol Impurity O Sulfate Salt
TRC-S085555-50MG 50 mg

Salbutamol Impurity O Sulfate Salt

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (ID8), 0.2mg/mL
BNUB0920-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (ID8), 0.2mg/mL

Sign In for Pricing
View Details
SLC39A7 (NM_001077516) Human Over-expression Lysate
LC421455 20 µg

SLC39A7 (NM_001077516) Human Over-expression Lysate

Sign In for Pricing
View Details
PPP1A (PPP1CA) (NM_001008709) Human Over-expression Lysate
LC423356 20 µg

PPP1A (PPP1CA) (NM_001008709) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTR1A (NM_005736) Human Over-expression Lysate
LY401749 100 µg

ACTR1A (NM_005736) Human Over-expression Lysate

Sign In for Pricing
View Details