Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit CD166 antigen (ALCAM)

This Recombinant Rabbit CD166 antigen (ALCAM) spans the amino acid sequence from region 1-521.

Product Specifications

Product Name Alternative

CD166 antigen, Activated leukocyte cell adhesion molecule, SB-10 antigen, CD_antigen= CD166

UniProt

O46651

Expression Region

1-521

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDDVF EAPTVVKVFKQPSKPEIVSKAPFLETEQLQKLGDCISRDSYPEGNITWYRNGKVLQPLEG AVVIIFKKQMDPVTQLYTMTSSLEYKTTKADIQTPFTCSITYYGPSGQKTVHSEQAVFDI YYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFFFYLPGQPEGIRSSNTYTLPN VRRNATGNYKCSLIDKKSLIASTAITVHYLDLSLNPXGELTKQIGDSLPVSCTISAIRNA TVVWMKDNIKLRSSPSFSSLQYQDAGNYVCETALQEVEGLKKRESLTLIVEVKPQIKMTK KTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVT LTCAAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALV AGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Soil Available Sulfur Content Assay Kit (Spectrophotometry)
CB0266S 50 Tests

Soil Available Sulfur Content Assay Kit (Spectrophotometry)

Sign In for Pricing
View Details
WDR88 CRISPR Activation Plasmid (h)
sc-414260-ACT 20 µg

WDR88 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Recombinant Pichia pastoris Golgi to ER traffic protein 1 (GET1)
orb2929476-01 20 µg

Recombinant Pichia pastoris Golgi to ER traffic protein 1 (GET1)

Sign In for Pricing
View Details
Recombinant Pichia pastoris Golgi to ER traffic protein 1 (GET1)
orb2929476-02 100 µg

Recombinant Pichia pastoris Golgi to ER traffic protein 1 (GET1)

Sign In for Pricing
View Details
Induced Myeloid Leukemia Cell Differentiation Protein (MCL1) Antibody
abx449776-01 10x 96 Tests

Induced Myeloid Leukemia Cell Differentiation Protein (MCL1) Antibody

Sign In for Pricing
View Details
Induced Myeloid Leukemia Cell Differentiation Protein (MCL1) Antibody
abx449776-02 5x 96 Tests

Induced Myeloid Leukemia Cell Differentiation Protein (MCL1) Antibody

Sign In for Pricing
View Details