Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calnexin (Canx)

This Recombinant Mouse Calnexin (Canx) spans the amino acid sequence from region 21-591.

Product Specifications

Product Name Alternative

Calnexin

UniProt

P35564

Expression Region

21-591

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDEEEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IFNA21 Antibody
RC-3897-01 50 μL

Recombinant IFNA21 Antibody

Sign In for Pricing
View Details
Recombinant IFNA21 Antibody
RC-3897-02 100 µL

Recombinant IFNA21 Antibody

Sign In for Pricing
View Details
Recombinant IFNA21 Antibody
RC-3897-03 1 mL

Recombinant IFNA21 Antibody

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF647 conjugate, 0.1mg/mL
BNC472368-500 1x 500 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C16orf9 (FAM234A) activation kit by CRISPRa
GA113328 1 Kit

Human C16orf9 (FAM234A) activation kit by CRISPRa

Sign In for Pricing
View Details
St3gal5 Mouse Gene Knockout Kit (CRISPR)
KN516800 1 Kit

St3gal5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details